- Basic
- Aromatic
- Nonpolar
- Polar
- Acidic
Backbone, N to C · one bead per residue
Too many residues to draw atom by atom at this size.
CAS 123583-37-9StandardMade to order · 2–6 weeks
PYY (3-36), human
Y2 receptor preferring peptide YY
34 aa · 4049 g/mol · ≥95% (HPLC)
About this peptide
DPP-4 product of peptide YY, the circulating form that acts mainly at the Y2 receptor.
Reported research uses
- 01Y2 receptor pharmacology
- 02Appetite and gut–brain research
Specifications
- CAS number
- 123583-37-9
- Sequence
- IKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2
- Length
- 34 residues
- Molecular formula
- C₁₈₀H₂₇₉N₅₃O₅₄
- Molecular weight
- 4049 g/mol
- Purity
- ≥95% (HPLC)
- Counter-ion
- TFA (acetate on request)
- Appearance
- Lyophilised white powder
- Storage
- −20 °C, desiccated, protected from light
- Synonyms
- Peptide YY (3-36)
Values from the manufacturer’s documents and published sources, for reference only; the lot CoA is the reference. Reported uses are from the literature and are not a claim that the product is suitable or safe for any purpose. For laboratory research use only — not for human or veterinary use. Handle only by trained staff following the SDS. Synthesised after your order is verified; MS and HPLC data come with the lot.