- Basic
- Aromatic
- Nonpolar
- Polar
- Acidic
Backbone, N to C · one bead per residue
Too many residues to draw atom by atom at this size.
PeptideStandardMade to order · 2–6 weeks
LL-37, human
Cathelicidin antimicrobial peptide
37 aa · 4493 g/mol · ≥95% (HPLC)
About this peptide
37-residue human cathelicidin with antimicrobial and immunomodulatory activity.
Reported research uses
- 01Antimicrobial susceptibility assays
- 02Innate immune signalling
Specifications
- Sequence
- [LL-37, 37 aa]
- Length
- 37 residues
- Molecular formula
- C₂₀₅H₃₄₀N₆₀O₅₃
- Molecular weight
- 4493 g/mol
- Purity
- ≥95% (HPLC)
- Counter-ion
- TFA (acetate on request)
- Appearance
- Lyophilised white powder
- Storage
- −20 °C, desiccated, protected from light
- Synonyms
- hCAP18 (134-170); CAMP
Values from the manufacturer’s documents and published sources, for reference only; the lot CoA is the reference. Reported uses are from the literature and are not a claim that the product is suitable or safe for any purpose. For laboratory research use only — not for human or veterinary use. Handle only by trained staff following the SDS. Synthesised after your order is verified; MS and HPLC data come with the lot.