- Basic
- Aromatic
- Nonpolar
- Polar
- Acidic
Backbone, N to C · one bead per residue
Too many residues to draw atom by atom at this size.
PeptideEnhanced verificationMade to order · 2–6 weeks
GIP, human
Gastric inhibitory polypeptide (1-42)
42 aa · 4984 g/mol · ≥98% (HPLC)
Verified orders. Each order needs institutional verification and a signed end-use statement before it ships. Orders above typical research quantities are reviewed first. Why
About this peptide
Glucose-dependent insulinotropic polypeptide, the second incretin hormone.
Reported research uses
- 01GIP receptor agonist reference
- 02Incretin and adipocyte research
Specifications
- Sequence
- YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ
- Length
- 42 residues
- Molecular formula
- C₂₂₆H₃₃₈N₆₀O₆₆S
- Molecular weight
- 4984 g/mol
- Purity
- ≥98% (HPLC)
- Counter-ion
- TFA (acetate on request)
- Appearance
- Lyophilised white powder
- Storage
- −20 °C, desiccated, protected from light
- Synonyms
- Glucose-dependent insulinotropic polypeptide
Values from the manufacturer’s documents and published sources, for reference only; the lot CoA is the reference. Reported uses are from the literature and are not a claim that the product is suitable or safe for any purpose. For laboratory research use only — not for human or veterinary use. Handle only by trained staff following the SDS. Synthesised after your order is verified; MS and HPLC data come with the lot.