- Basic
- Aromatic
- Nonpolar
- Polar
- Acidic
Backbone, N to C · one bead per residue
Too many residues to draw atom by atom at this size.
PeptideEnhanced verificationMade to order · 2–6 weeks
GHRH (1-44) amide, human
Full-length growth hormone releasing hormone
44 aa · 5039.73 g/mol · ≥95% (HPLC)
Verified orders. Each order needs institutional verification and a signed end-use statement before it ships. Orders above typical research quantities are reviewed first. Why
About this peptide
The complete 44-residue hypothalamic GHRH, amidated at the C-terminus.
Reported research uses
- 01GHRH receptor agonist reference
- 02Pituitary somatotroph research
Specifications
- Sequence
- YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2
- Length
- 44 residues
- Molecular formula
- C₂₁₅H₃₅₈N₇₂O₆₆S
- Molecular weight
- 5039.73 g/mol
- Purity
- ≥95% (HPLC)
- Counter-ion
- TFA (acetate on request)
- Appearance
- Lyophilised white powder
- Storage
- −20 °C, desiccated, protected from light
- Synonyms
- Somatoliberin; GRF (1-44)
Values from the manufacturer’s documents and published sources, for reference only; the lot CoA is the reference. Reported uses are from the literature and are not a claim that the product is suitable or safe for any purpose. For laboratory research use only — not for human or veterinary use. Handle only by trained staff following the SDS. Synthesised after your order is verified; MS and HPLC data come with the lot.