- Basic
- Aromatic
- Nonpolar
- Polar
- Acidic
Backbone, N to C · one bead per residue
Too many residues to draw atom by atom at this size.
CAS 141758-74-9Enhanced verificationMade to order · 2–6 weeks
Exenatide
Exendin-4, GLP-1 receptor agonist
39 aa · 4187 g/mol · ≥98% (HPLC)
Verified orders. Each order needs institutional verification and a signed end-use statement before it ships. Orders above typical research quantities are reviewed first. Why
About this peptide
Synthetic exendin-4, the 39-residue peptide first isolated from Gila monster venom. Classic GLP-1R agonist and radioligand scaffold.
Reported research uses
- 01GLP-1R agonist reference in binding assays
- 02Scaffold for labelled imaging probes
Specifications
- CAS number
- 141758-74-9
- Sequence
- HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
- Length
- 39 residues
- Molecular formula
- C₁₈₄H₂₈₂N₅₀O₆₀S
- Molecular weight
- 4187 g/mol
- Purity
- ≥98% (HPLC)
- Counter-ion
- TFA (acetate on request)
- Appearance
- Lyophilised white powder
- Storage
- −20 °C, desiccated, protected from light
- Synonyms
- Exendin-4; AC2993
Values from the manufacturer’s documents and published sources, for reference only; the lot CoA is the reference. Reported uses are from the literature and are not a claim that the product is suitable or safe for any purpose. For laboratory research use only — not for human or veterinary use. Handle only by trained staff following the SDS. Synthesised after your order is verified; MS and HPLC data come with the lot.